Recombinant Human ANKRD9 protein, GST-tagged
Cat.No. : | ANKRD9-609H |
Product Overview : | Human ANKRD9 full-length ORF ( NP_689539.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD9 (Ankyrin Repeat Domain 9) is a Protein Coding gene. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFHWDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALAVRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTPVGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD9 ankyrin repeat domain 9 [ Homo sapiens ] |
Official Symbol | ANKRD9 |
Synonyms | 2500003O20Rik; ANKR9_HUMAN; Ankrd9; Ankyrin repeat domain 9; Ankyrin repeat domain-containing protein 9; MGC21990; ANKRD9 |
Gene ID | 122416 |
mRNA Refseq | NM_152326.2 |
Protein Refseq | NP_689539.1 |
UniProt ID | Q96BM1 |
◆ Recombinant Proteins | ||
IFNG-24H | Active Recombinant Human IFNG, His-tagged | +Inquiry |
ZDHHC8B-9600Z | Recombinant Zebrafish ZDHHC8B | +Inquiry |
RFL11839MF | Recombinant Full Length Macaca Fascicularis Vesicle-Trafficking Protein Sec22A(Sec22A) Protein, His-Tagged | +Inquiry |
Efhc1-2750M | Recombinant Mouse Efhc1 Protein, Myc/DDK-tagged | +Inquiry |
RFL13238AF | Recombinant Full Length Atp Synthase Subunit A(Atp6) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
C-type lectin like protein-042H | Native Hen C-type lectin like protein Protein, FITC conjugated | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPO-913HCL | Recombinant Human TMPO 293 Cell Lysate | +Inquiry |
PFN4-3265HCL | Recombinant Human PFN4 293 Cell Lysate | +Inquiry |
DTWD1-6795HCL | Recombinant Human DTWD1 293 Cell Lysate | +Inquiry |
BMP15-66HCL | Recombinant Human BMP15 lysate | +Inquiry |
Thymus-127M | Mouse Thymus Tissue Lysate (7 Days Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD9 Products
Required fields are marked with *
My Review for All ANKRD9 Products
Required fields are marked with *
0
Inquiry Basket