Recombinant Human ANKRD54 protein, GST-tagged

• Cat.No.: ANKRD54-605H
• Product Overview: Human ANKRD54 full-length ORF (BAC87043.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKRD54 (Ankyrin Repeat Domain 54) is a Protein Coding gene. GO annotations related to this gene include protein complex binding and protein kinase regulator activity. An important paralog of this gene is ANKRD23.
• Molecular Mass: 44.7 kDa
• AA Sequence: MVLILTSEMGWGTRHCTWRPAPTTFLSSPHCYEEVCGFFPSLSSFSPSPPECSPQLVPAGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD54 ankyrin repeat domain 54 [ Homo sapiens ]
• Official Symbol: ANKRD54
• Synonyms: ANKRD54; ankyrin repeat domain 54; ankyrin repeat domain-containing protein 54; LIAR
• Gene ID: 129138
• mRNA Refseq: NM_138797
• Protein Refseq: NP_620152
• MIM: 613383
• UniProt ID: Q6NXT1