Recombinant Human ANKRD16 protein, GST-tagged
| Cat.No. : | ANKRD16-577H |
| Product Overview : | Human ANKRD16 full-length ORF ( NP_001009941.1, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | ANKRD16 (Ankyrin Repeat Domain 16) is a Protein Coding gene. An important paralog of this gene is FEM1A. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 65.7 kDa |
| AA Sequence : | MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD16 ankyrin repeat domain 16 [ Homo sapiens ] |
| Official Symbol | ANKRD16 |
| Synonyms | ANKRD16; ankyrin repeat domain 16 |
| Gene ID | 54522 |
| mRNA Refseq | NM_019046.2 |
| Protein Refseq | NP_061919.1 |
| UniProt ID | Q6P6B7 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD16 Products
Required fields are marked with *
My Review for All ANKRD16 Products
Required fields are marked with *
0
Inquiry Basket
