Recombinant Human ANKRD10 protein, GST-tagged

Cat.No. : ANKRD10-571H
Product Overview : Human ANKRD10 full-length ORF ( AAH01727.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD10 (Ankyrin Repeat Domain 10) is a Protein Coding gene. An important paralog of this gene is ANKRD37.
Molecular Mass : 49.9 kDa
AA Sequence : MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGKLECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLECISALVANGAHVEFISQSSVHSCLPGELQHGVTFDPSVLIQCLKPEKCQWPDSSRHCTNPGFPRVCPVSLEPPELSSEPFL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD10 ankyrin repeat domain 10 [ Homo sapiens ]
Official Symbol ANKRD10
Synonyms Ankrd10; Ankyrin repeat domain-containing protein 10; ANR10_HUMAN; RP11-120J20.3; ANKRD10
Gene ID 55608
mRNA Refseq NM_017664.2
Protein Refseq NP_060134.2
UniProt ID Q9NXR5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANKRD10 Products

Required fields are marked with *

My Review for All ANKRD10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon