Recombinant Human ANKRD10 protein, GST-tagged

• Cat.No.: ANKRD10-571H
• Product Overview: Human ANKRD10 full-length ORF ( AAH01727.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANKRD10 (Ankyrin Repeat Domain 10) is a Protein Coding gene. An important paralog of this gene is ANKRD37.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 49.9 kDa
• AA Sequence: MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGKLECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLECISALVANGAHVEFISQSSVHSCLPGELQHGVTFDPSVLIQCLKPEKCQWPDSSRHCTNPGFPRVCPVSLEPPELSSEPFL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD10 ankyrin repeat domain 10 [ Homo sapiens ]
• Official Symbol: ANKRD10
• Synonyms: Ankrd10; Ankyrin repeat domain-containing protein 10; ANR10_HUMAN; RP11-120J20.3; ANKRD10
• Gene ID: 55608
• mRNA Refseq: NM_017664.2
• Protein Refseq: NP_060134.2
• UniProt ID: Q9NXR5