Recombinant Human ANKRD1 protein, T7/His-tagged

• Cat.No.: ANKRD1-235H
• Product Overview: Recombinant human ANKRD1 cDNA (2–319 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 2-319 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKT LLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVP TFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGG NLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLI MYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: ANKRD1 ankyrin repeat domain 1 (cardiac muscle) [ Homo sapiens ]
• Official Symbol: ANKRD1
• Synonyms: ANKRD1; ankyrin repeat domain 1 (cardiac muscle); ankyrin repeat domain-containing protein 1; ALRP; C 193; CARP; CVARP; MCARP; liver ankyrin repeat domain 1; cardiac ankyrin repeat protein; cytokine-inducible nuclear protein; cytokine-inducible gene C-193 protein; C-193; bA320F15.2
• Gene ID: 27063
• mRNA Refseq: NM_014391
• Protein Refseq: NP_055206
• MIM: 609599
• UniProt ID: Q15327
• Chromosome Location: 10q23.33
• Pathway: Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Hypertrophy Model, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem
• Function: DNA binding; R-SMAD binding; RNA polymerase II transcription coactivator activity; RNA polymerase II transcription factor binding; histone deacetylase binding; p53 binding; protein binding; titin binding; transcription corepressor activity