Recombinant Human ANK3 protein, His-tagged

• Cat.No.: ANK3-5633H
• Product Overview: Recombinant Human ANK3 protein(Q12955)(4088-4199aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 4088-4199aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 14.1 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG

Gene Information

• Gene Name: ANK3 ankyrin 3, node of Ranvier (ankyrin G) [ Homo sapiens ]
• Official Symbol: ANK3
• Synonyms: ANK3; ankyrin 3, node of Ranvier (ankyrin G); ankyrin-3; ankyrin 3; node of Ranvier; ankyrin G; ankyrin G119; ANKYRIN-G; FLJ45464
• Gene ID: 288
• mRNA Refseq: NM_001149
• Protein Refseq: NP_001140
• MIM: 600465
• UniProt ID: Q12955