Recombinant Human ANGPTL7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ANGPTL7-1782H |
Product Overview : | ANGPTL7 MS Standard C13 and N15-labeled recombinant protein (NP_066969) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure. Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency. |
Molecular Mass : | 40 kDa |
AA Sequence : | MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ANGPTL7 angiopoietin-like 7 [ Homo sapiens (human) ] |
Official Symbol | ANGPTL7 |
Synonyms | ANGPTL7; angiopoietin-like 7; angiopoietin-related protein 7; AngX; CDT6; angiopoietin-like protein 7; angiopoietin-like factor (CDT6); cornea-derived transcript 6 protein; dJ647M16.1; RP4-647M16.2; |
Gene ID | 10218 |
mRNA Refseq | NM_021146 |
Protein Refseq | NP_066969 |
MIM | 618517 |
UniProt ID | O43827 |
◆ Recombinant Proteins | ||
ANGPTL7-1281C | Recombinant Canine ANGPTL7 protein(Met1-Pro344), hFc-tagged | +Inquiry |
ANGPTL7-01H | Recombinant Human ANGPTL7 protein, hIgG-tagged | +Inquiry |
ANGPTL7-409H | Recombinant Human ANGPTL7, Fibrinogen-like Domain, FLAG-tagged | +Inquiry |
Angptl7-1574M | Recombinant Mouse Angptl7 protein, His-tagged | +Inquiry |
ANGPTL7-2079H | Recombinant Human ANGPTL7 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL7-766CCL | Recombinant Cynomolgus ANGPTL7 cell lysate | +Inquiry |
ANGPTL7-769CCL | Recombinant Canine ANGPTL7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANGPTL7 Products
Required fields are marked with *
My Review for All ANGPTL7 Products
Required fields are marked with *
0
Inquiry Basket