Recombinant Human ANGPTL6 protein, GST-tagged

• Cat.No.: ANGPTL6-559H
• Product Overview: Human ANGPTL6 partial ORF (NP_114123, 211 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANGPTL6 (Angiopoietin Like 6) is a Protein Coding gene. Diseases associated with ANGPTL6 include Gnathomiasis and Enterobiasis. Among its related pathways are Activation of cAMP-Dependent PKA and GPCR Pathway. An important paralog of this gene is ANGPTL2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.53 kDa
• AA Sequence: GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANGPTL6 angiopoietin-like 6 [ Homo sapiens ]
• Official Symbol: ANGPTL6
• Synonyms: ANGPTL6; angiopoietin-like 6; angiopoietin-related protein 6; AGF; angiopoietin related protein 5; ARP5; angiopoietin-like protein 6; angiopoietin-related protein 5; angiopoietin-related growth factor
• Gene ID: 83854
• mRNA Refseq: NM_031917
• Protein Refseq: NP_114123
• MIM: 609336
• UniProt ID: Q8NI99