Recombinant Human ANGPT1/COMP protein, FLAG-tagged

• Cat.No.: ANGPT1-35H
• Product Overview: Recombinant Human ANGPT1(256–498 (end)) fused with FLAG tag at N-terminal and Mouse COMP(28–72) was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 256-498 a.a.
• Form: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.05% Tween-20, 100 ng/µl FLAG peptide, 20% glycerol, and 1 mM DTT.
• Molecular Mass: 34 kDa
• AA Sequence: DYKDDDDKDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACGDTVHNLVNLCTKEGVLLKGGKR EEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNP SGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFS TKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
• Purity: >90%
• Applications: Useful for the study of signaling pathways. Also useful for receptor binding studies, screening inhibitors, and selectivity profiling.
• Storage: >6 months at –80 centigrade. Avoid freeze/thaw cycles.

Gene Information

• Gene Name: ANGPT1 angiopoietin 1 [ Homo sapiens ]
• Official Symbol: ANGPT1
• Synonyms: ANGPT1; angiopoietin 1; angiopoietin-1; Ang1; KIAA0003; ANG-1; AGP1; AGPT; ANG1
• Gene ID: 284
• mRNA Refseq: NM_001146
• Protein Refseq: NP_001137
• MIM: 601667
• UniProt ID: Q15389
• Chromosome Location: 8q23.1
• Pathway: Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem; Tie2 Signaling, organism-specific biosystem
• Function: receptor tyrosine kinase binding