Recombinant Human AMPD2 protein, His-tagged

• Cat.No.: AMPD2-7854H
• Product Overview: Recombinant Human AMPD2 protein(448-798 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Tag: N-His
• ProteinLength: 448-798 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: LEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: AMPD2 adenosine monophosphate deaminase 2 [ Homo sapiens ]
• Official Symbol: AMPD2
• Synonyms: AMPD2; adenosine monophosphate deaminase 2; adenosine monophosphate deaminase 2 (isoform L); AMP deaminase 2; AMPD isoform L; AMPD
• Gene ID: 271
• mRNA Refseq: NM_001257360
• Protein Refseq: NP_001244289
• MIM: 102771
• UniProt ID: Q01433