Recombinant Human AMPD2

• Cat.No.: AMPD2-27197TH
• Product Overview: Recombinant fragment of Human AMPD2, isoform Ex1A-2-3 with N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Description: Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Three isoforms are present in mammals: AMP deaminase 1 is the predominant form in skeletal muscle; AMP deaminase 2 predominates in smooth muscle, non-muscle tissue, embryonic muscle and undifferentiated myoblasts; AMP deaminase 3 is found in erythrocytes.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
• Sequence Similarities: Belongs to the adenosine and AMP deaminases family.
• Tag: Non

Gene Information

• Gene Name: AMPD2 adenosine monophosphate deaminase 2 [ Homo sapiens ]
• Official Symbol: AMPD2
• Synonyms: AMPD2; adenosine monophosphate deaminase 2; adenosine monophosphate deaminase 2 (isoform L); AMP deaminase 2; AMPD isoform L
• Gene ID: 271
• mRNA Refseq: NM_004037
• Protein Refseq: NP_004028
• MIM: 102771
• Uniprot ID: Q01433
• Chromosome Location: 1p13.3
• Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, organism-specific biosystem
• Function: AMP deaminase activity; hydrolase activity; metal ion binding