Recombinant Human AMIGO3, His-tagged
Cat.No. : | AMIGO3-29H |
Product Overview : | Recombinant Human Amphoterin-Induced Protein 3/AMIGO3 produced by transfected human cells is a secreted protein with sequence (Thr20-Thr383) of Human AMIGO3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-383 a.a. |
Description : | Amphoterin-Induced Gene and ORF 3 (AMIGO3) is a member of the AMIGO family. AMIGO family proteins are cell adhesion molecules, which exhibits homophilic and heterophilic binding properties, plays an important role in neuronal axon tract development. AMIGO3 is a type I transmembrane proteins, includes six leucine-rich repeats (CRRs) and Ig domain in the extracellular domains. AMIGO3 can be expressed and detected in all tissues, may mediates heterophilic cell-cell interaction, contributes to signal transduction through its intracellular domain. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | TPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQRLRPGWLAPL FQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNTLRALGRHDLDGLGALEKLLLFNNRLVHLD EHAFHGLRALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFLKNGL YLHNNPLPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPAL GLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQE QHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | AMIGO3 adhesion molecule with Ig-like domain 3 [ Homo sapiens ] |
Official Symbol | AMIGO3 |
Synonyms | AMIGO3; adhesion molecule with Ig-like domain 3; amphoterin-induced protein 3; amphoterin induced gene and open reading frame 3; alivin-3; amphoterin-induced gene and ORF 3; AMIGO-3; MGC120552; |
Gene ID | 386724 |
mRNA Refseq | NM_198722 |
Protein Refseq | NP_942015 |
UniProt ID | Q86WK7 |
Chromosome Location | 3p21 |
◆ Recombinant Proteins | ||
AMIGO3-29H | Recombinant Human AMIGO3, His-tagged | +Inquiry |
AMIGO3-1600M | Recombinant Mouse AMIGO3 Protein | +Inquiry |
AMIGO3-525H | Recombinant Human AMIGO3 protein, GST-tagged | +Inquiry |
AMIGO3-310R | Recombinant Rat AMIGO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMIGO3-506M | Recombinant Mouse AMIGO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMIGO3-8881HCL | Recombinant Human AMIGO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMIGO3 Products
Required fields are marked with *
My Review for All AMIGO3 Products
Required fields are marked with *
0
Inquiry Basket