Recombinant Human AMIGO3, His-tagged

• Cat.No.: AMIGO3-29H
• Product Overview: Recombinant Human Amphoterin-Induced Protein 3/AMIGO3 produced by transfected human cells is a secreted protein with sequence (Thr20-Thr383) of Human AMIGO3 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Amphoterin-Induced Gene and ORF 3 (AMIGO3) is a member of the AMIGO family. AMIGO family proteins are cell adhesion molecules, which exhibits homophilic and heterophilic binding properties, plays an important role in neuronal axon tract development. AMIGO3 is a type I transmembrane proteins, includes six leucine-rich repeats (CRRs) and Ig domain in the extracellular domains. AMIGO3 can be expressed and detected in all tissues, may mediates heterophilic cell-cell interaction, contributes to signal transduction through its intracellular domain.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: TPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQRLRPGWLAPL FQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNTLRALGRHDLDGLGALEKLLLFNNRLVHLD EHAFHGLRALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFLKNGL YLHNNPLPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPAL GLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQE QHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Protein length: 20-383 a.a.

Gene Information

• Gene Name: AMIGO3 adhesion molecule with Ig-like domain 3 [ Homo sapiens ]
• Official Symbol: AMIGO3
• Synonyms: AMIGO3; adhesion molecule with Ig-like domain 3; amphoterin-induced protein 3; amphoterin induced gene and open reading frame 3; alivin-3; amphoterin-induced gene and ORF 3; AMIGO-3; MGC120552
• Gene ID: 386724
• mRNA Refseq: NM_198722
• Protein Refseq: NP_942015
• UniProt ID: Q86WK7
• Chromosome Location: 3p21