Recombinant Human Alpha-Synuclein Protein, 13C, 15N Label

Cat.No. : ASNC-309H
Product Overview : Recombinant Human Alpha-Synuclein Protein, 13C, 15N Uniform Label is expressed in Escherichia coli in minimal media using 15NH4Cl as sole nitrogen source and 13C-glucose as sole carbon source. Counter Ion: Ammonium Carbonate.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Form : Lyophilized, Alpha-Synuclein is readily soluble in PBS.
AA Sequence : MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity : > 95% HPLC and SDS-PAGE
Storage : Store at -20 centigrade upon arrival.

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASNC Products

Required fields are marked with *

My Review for All ASNC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon