Recombinant Human ALAS2 Protein, GST-tagged

• Cat.No.: ALAS2-431H
• Product Overview: Human ALAS2 partial ORF ( NP_000023, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALAS2 aminolevulinate, delta-, synthase 2 [ Homo sapiens ]
• Official Symbol: ALAS2
• Synonyms: ALAS2; aminolevulinate, delta-, synthase 2; aminolevulinate, delta , synthase 2 (sideroblastic/hypochromic anemia) , ASB; 5-aminolevulinate synthase, erythroid-specific, mitochondrial; sideroblastic/hypochromic anemia; delta-ALA synthase 2; delta-ALA synthetase; 5-aminolevulinic acid synthase 2; delta-aminolevulinate synthase 2; ASB; ANH1; XLSA; ALASE; XLDPP; XLEPP; ALAS-E; FLJ93603
• Gene ID: 212
• mRNA Refseq: NM_000032
• Protein Refseq: NP_000023
• MIM: 301300
• UniProt ID: P22557