Recombinant Human AKR1C8P Protein, GST-tagged

Cat.No. : AKR1C8P-415H
Product Overview : Human AKR1CL1 full-length ORF ( NP_001007537.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AKR1C8P (Aldo-Keto Reductase Family 1 Member C8, Pseudogene) is a Pseudogene. GO annotations related to this gene include oxidoreductase activity.
Molecular Mass : 41 kDa
AA Sequence : MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKR1C8P aldo-keto reductase family 1 member C8, pseudogene [ Homo sapiens (human) ]
Official Symbol AKR1C8P
Synonyms AKR1C8P; aldo-keto reductase family 1 member C8, pseudogene; AKR1CL1; Aldo-Keto Reductase Family 1 Member C8, Pseudogene; Aldo-Keto Reductase Family 1, Member C-Like 1; Aldo-Keto Reductase Family 1 Member C-Like Protein 1; Protein RAKc; EC 1.1.1.-
Gene ID 340811

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AKR1C8P Products

Required fields are marked with *

My Review for All AKR1C8P Products

Required fields are marked with *

0

Inquiry Basket

cartIcon