Recombinant Human AKR1C1 Protein, GST-tagged

• Cat.No.: AKR1C1-411H
• Product Overview: Human AKR1C1 full-length ORF ( NP_001344.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 63.2 kDa
• AA Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKR1C1 aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) [ Homo sapiens ]
• Official Symbol: AKR1C1
• Synonyms: AKR1C1; aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase); DDH1; aldo-keto reductase family 1 member C1; DD1; DDH; HAKRC; MBAB; aldo-keto reductase C; indanol dehydrogenase; dihydrodiol dehydrogenase 1; dihydrodiol dehydrogenase 1/2; hepatic dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRC; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; dihydrodiol dehydrogenase isoform DD1; type II 3-alpha-hydroxysteroid dehydrogenase; high-affinity hepatic bile acid-binding protein; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; C9; H-37; HBAB; DD1/DD2; 2-ALPHA-HSD; 20-ALPHA-HSD; MGC8954
• Gene ID: 1645
• mRNA Refseq: NM_001353
• Protein Refseq: NP_001344
• MIM: 600449
• UniProt ID: Q04828