Recombinant Human AKR1B1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AKR1B1-3168H
• Product Overview: AKR1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001619) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 35.7 kDa
• AA Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AKR1B1 aldo-keto reductase family 1 member B [ Homo sapiens (human) ]
• Official Symbol: AKR1B1
• Synonyms: AKR1B1; aldo-keto reductase family 1, member B1 (aldose reductase); ALDR1; aldose reductase; AR; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1; ADR; ALR2; MGC1804
• Gene ID: 231
• mRNA Refseq: NM_001628
• Protein Refseq: NP_001619
• MIM: 103880
• UniProt ID: P15121