Recombinant Human AKR1B1 protein(11-290 aa), C-His-tagged

• Cat.No.: AKR1B1-2656H
• Product Overview: Recombinant Human AKR1B1 protein(P15121)(11-290 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 11-290 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: AKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLL
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: AKR1B1 aldo-keto reductase family 1, member B1 (aldose reductase) [ Homo sapiens ]
• Official Symbol: AKR1B1
• Synonyms: AKR1B1; aldo-keto reductase family 1, member B1 (aldose reductase); ALDR1; aldose reductase; AR; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1; ADR; ALR2; MGC1804
• Gene ID: 231
• mRNA Refseq: NM_001628
• Protein Refseq: NP_001619
• MIM: 103880
• UniProt ID: P15121