Recombinant Human AKAP7

Cat.No. : AKAP7-26524TH
Product Overview : Recombinant full length Human AKAP7 produced in Saccharomyces cerevisiae; amino acids 1-81; 81 amino acids, 8.9kDa. Protein has a 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-81 a.a.
Description : This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.
Tissue specificity : Expressed in brain, heart, lung, pancreas and skeletal muscle.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENA VLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNEN NRK
Full Length : Full L.
Gene Name AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ]
Official Symbol AKAP7
Synonyms AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18;
Gene ID 9465
mRNA Refseq NM_004842
Protein Refseq NP_004833
MIM 604693
Uniprot ID O43687
Chromosome Location 6q22-q24
Pathway G Protein Signaling Pathways, organism-specific biosystem;
Function AMP binding; catalytic activity; protein C-terminus binding; protein complex scaffold; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AKAP7 Products

Required fields are marked with *

My Review for All AKAP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon