Recombinant Human AIF1L Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AIF1L-3887H
• Product Overview: AIF1L MS Standard C13 and N15-labeled recombinant protein (NP_113614) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: AIF1L (Allograft Inflammatory Factor 1 Like) is a Protein Coding gene. Diseases associated with AIF1L include Bronchus Cancer. Gene Ontology (GO) annotations related to this gene include calcium ion binding and actin filament binding. An important paralog of this gene is AIF1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.9 kDa
• AA Sequence: MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AIF1L allograft inflammatory factor 1-like [ Homo sapiens (human) ]
• Official Symbol: AIF1L
• Synonyms: AIF1L; allograft inflammatory factor 1-like; C9orf58, chromosome 9 open reading frame 58; FLJ12783; IBA2; ionized calcium binding adapter molecule 2; ionized calcium-binding adapter molecule 2; C9orf58; MGC29466
• Gene ID: 83543
• mRNA Refseq: NM_031426
• Protein Refseq: NP_113614
• UniProt ID: Q9BQI0