Recombinant Human AHSG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AHSG-2173H |
Product Overview : | AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AHSG alpha-2-HS-glycoprotein [ Homo sapiens (human) ] |
Official Symbol | AHSG |
Synonyms | AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS; |
Gene ID | 197 |
mRNA Refseq | NM_001622 |
Protein Refseq | NP_001613 |
MIM | 138680 |
UniProt ID | P02765 |
◆ Recombinant Proteins | ||
AHSG-470H | Recombinant Human AHSG Protein, GST-tagged | +Inquiry |
AHSG-101C | Recombinant Cattle AHSG Protein, His-tagged | +Inquiry |
Ahsg-7155M | Recombinant Mouse Ahsg Protein, His-tagged | +Inquiry |
Ahsg-408M | Recombinant Mouse Ahsg Protein, His (Fc)-Avi-tagged | +Inquiry |
Ahsg-92M | Recombinant Mouse Ahsg, His-tagged | +Inquiry |
◆ Native Proteins | ||
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *
0
Inquiry Basket