Recombinant Human AHSG protein(141-280 aa), C-His-tagged

• Cat.No.: AHSG-2529H
• Product Overview: Recombinant Human AHSG protein(P02765)(141-280 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 141-280 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPS

Gene Information

• Gene Name: AHSG alpha-2-HS-glycoprotein [ Homo sapiens ]
• Official Symbol: AHSG
• Synonyms: AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS
• Gene ID: 197
• mRNA Refseq: NM_001622
• Protein Refseq: NP_001613
• MIM: 138680
• UniProt ID: P02765