Recombinant Human AFP, StrepII-tagged

• Cat.No.: AFP-225H
• Product Overview: Purified, full-length human recombinant Alpha-fetoprotein or aFP protein (amino acids 20-609, 590 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 66.3 kDa. (Accession NP_001125; UniProt P02771)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 20-609, 590 a.a.
• Description: Alpha-fetoprotein is a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistence of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids, and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. The protein belongs to the ALB/AFP/VDB family and contains 3 albumin domains.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: TLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAF LEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARR HPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITVTKLS QKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAEN DEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQ DKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKL LACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVA LQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: AFP alpha-fetoprotein [ Homo sapiens ]
• Official Symbol: AFP
• Synonyms: AFP; alpha-fetoprotein; HPAFP; FETA; alpha-fetoglobulin; alpha-1-fetoprotein
• Gene ID: 174
• mRNA Refseq: NM_001134
• Protein Refseq: NP_001125
• UniProt ID: P02771
• Chromosome Location: 4q11-q13
• Pathway: Direct p53 effectors, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem
• Function: metal ion binding