Recombinant Human ADRBK1 protein, His-tagged

• Cat.No.: ADRBK1-9445H
• Product Overview: Recombinant Human ADRBK1 protein(390-689 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 390-689 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL

Gene Information

• Gene Name: ADRBK1 adrenergic, beta, receptor kinase 1 [ Homo sapiens ]
• Official Symbol: ADRBK1
• Synonyms: ADRBK1; adrenergic, beta, receptor kinase 1; beta-adrenergic receptor kinase 1; BARK1; GRK2; beta-ARK-1; G-protein coupled receptor kinase 2; BETA-ARK1; FLJ16718
• Gene ID: 156
• mRNA Refseq: NM_001619
• Protein Refseq: NP_001610
• MIM: 109635
• UniProt ID: P25098