Recombinant Human ADRB1 Protein (378-477 aa), His-tagged

• Cat.No.: ADRB1-1319H
• Product Overview: Recombinant Human ADRB1 Protein (378-477 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 378-477 aa
• Description: Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.5 kDa
• AA Sequence: CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ADRB1 adrenergic, beta-1-, receptor [ Homo sapiens ]
• Official Symbol: ADRB1
• Synonyms: ADRB1; ADRB1R; RHR; B1AR; BETA1AR
• Gene ID: 153
• mRNA Refseq: NM_000684
• Protein Refseq: NP_000675
• UniProt ID: P08588