Recombinant Human ADPRH Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ADPRH-2357H
Product Overview : ADPRH MS Standard C13 and N15-labeled recombinant protein (NP_001116) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described.
Molecular Mass : 39.5 kDa
AA Sequence : MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ADPRH ADP-ribosylarginine hydrolase [ Homo sapiens (human) ]
Official Symbol ADPRH
Synonyms ADPRH; ADP-ribosylarginine hydrolase; ARH1; hARH1; ADP-ribosylarginine hydrolase; ADP-ribose-L-arginine cleaving enzyme; [Protein ADP-ribosylarginine] hydrolase; EC 3.2.2.19
Gene ID 141
mRNA Refseq NM_001125
Protein Refseq NP_001116
MIM 603081
UniProt ID P54922

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADPRH Products

Required fields are marked with *

My Review for All ADPRH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon