Recombinant Human ADPRH Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ADPRH-2357H
• Product Overview: ADPRH MS Standard C13 and N15-labeled recombinant protein (NP_001116) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 39.5 kDa
• AA Sequence: MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ADPRH ADP-ribosylarginine hydrolase [ Homo sapiens (human) ]
• Official Symbol: ADPRH
• Synonyms: ADPRH; ADP-ribosylarginine hydrolase; ARH1; hARH1; ADP-ribosylarginine hydrolase; ADP-ribose-L-arginine cleaving enzyme; [Protein ADP-ribosylarginine] hydrolase; EC 3.2.2.19
• Gene ID: 141
• mRNA Refseq: NM_001125
• Protein Refseq: NP_001116
• MIM: 603081
• UniProt ID: P54922