Recombinant Human ADPGK protein, GST-tagged

Cat.No. : ADPGK-33H
Product Overview : Recombinant Human ADPGK(1 a.a. - 497 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-497 a.a.
Description : ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 80.5 kDa
AA Sequence : MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ADPGK ADP-dependent glucokinase [ Homo sapiens ]
Official Symbol ADPGK
Synonyms ADPGK; ADP-dependent glucokinase; ADP GK; DKFZp434B195; rbBP-35; ATP-dependent glucokinase; ADP-GK; 2610017G09Rik;
Gene ID 83440
mRNA Refseq NM_031284
Protein Refseq NP_112574
MIM 611861
UniProt ID Q9BRR6
Chromosome Location 15q24.1
Pathway Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function ADP-specific glucokinase activity; metal ion binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADPGK Products

Required fields are marked with *

My Review for All ADPGK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon