Recombinant Human ADM Protein, GST-tagged
Cat.No. : | ADM-362H |
Product Overview : | Human ADM full-length ORF (BAG35740.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. [provided by RefSeq, Aug 2014] |
Molecular Mass : | 46.75 kDa |
AA Sequence : | MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADM adrenomedullin [ Homo sapiens ] |
Official Symbol | ADM |
Synonyms | ADM; adrenomedullin; AM; preproadrenomedullin; |
Gene ID | 133 |
mRNA Refseq | NM_001124 |
Protein Refseq | NP_001115 |
MIM | 103275 |
UniProt ID | P35318 |
◆ Recombinant Proteins | ||
ADM-85H | Recombinant Human ADM Protein, His&SUMO-tagged | +Inquiry |
Adm-3202M | Recombinant Mouse Adm, GST-tagged | +Inquiry |
ADM-856H | Recombinant Human ADM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Adm-234M | Recombinant Mouse Adm Protein, His-tagged | +Inquiry |
ADM-1365M | Recombinant Mouse ADM Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADM-1530HCL | Recombinant Human ADM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADM Products
Required fields are marked with *
My Review for All ADM Products
Required fields are marked with *
0
Inquiry Basket