Recombinant Human ADIG Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ADIG-4791H |
| Product Overview : | ADIG MS Standard C13 and N15-labeled recombinant protein (NP_001018092) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | ADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation. |
| Source : | HEK293 |
| Species : | Human |
| Tag : | Myc&DDK |
| Molecular Mass : | 9.5 kDa |
| AA Sequence : | MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERPCWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ADIG adipogenin [ Homo sapiens (human) ] |
| Official Symbol | ADIG |
| Synonyms | adipogenin; SMAF1; adipogenesis associated; MGC39724; RP5-1100H13.2; small adipocyte factor 1 (SMAF1) |
| Gene ID | 149685 |
| mRNA Refseq | NM_001018082 |
| Protein Refseq | NP_001018092 |
| MIM | 611396 |
| UniProt ID | Q0VDE8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADIG Products
Required fields are marked with *
My Review for All ADIG Products
Required fields are marked with *
0
Inquiry Basket
