Recombinant Human ADIG Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ADIG-4791H
• Product Overview: ADIG MS Standard C13 and N15-labeled recombinant protein (NP_001018092) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation.
• Molecular Mass: 9.5 kDa
• AA Sequence: MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERPCWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ADIG adipogenin [ Homo sapiens (human) ]
• Official Symbol: ADIG
• Synonyms: adipogenin; SMAF1; adipogenesis associated; MGC39724; RP5-1100H13.2; small adipocyte factor 1 (SMAF1)
• Gene ID: 149685
• mRNA Refseq: NM_001018082
• Protein Refseq: NP_001018092
• MIM: 611396
• UniProt ID: Q0VDE8