Recombinant Human ADGRL4 protein, T7/His-tagged
Cat.No. : | ADGRL4-207H |
Product Overview : | Recombinant human ELTD1 cDNA (85-432aa, derived from BC025721) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
ProteinLength : | 85-432 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTL TKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTISAKDTLSNSTLTEFVKTVNNFVQRD TFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYIN IFPKRKAAYDSNGNVAVAFVYYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITF TLSHRKVTDRYRSLCAFWNYSPDTMNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIGIKDYNILTRI TQ |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | ADGRL4 adhesion G protein-coupled receptor L4 [ Homo sapiens ] |
Official Symbol | ADGRL4 |
Synonyms | ETL; ELTD1; KPG_003; EGF, latrophilin and seven transmembrane domain-containing protein 1; EGF-TM7-latrophilin-related protein |
Gene ID | 64123 |
mRNA Refseq | NM_022159 |
Protein Refseq | NP_071442 |
MIM | 616419 |
UniProt ID | Q9HBW9 |
Chromosome Location | 1p33-p32 |
Pathway | GPCRs, Class B Secretin-like, organism-specific biosystem |
Function | G-protein coupled receptor activity; calcium ion binding; protein dimerization activity |
◆ Recombinant Proteins | ||
CDK1/CyclinB1-48H | Recombinant Human CDK1/CyclinB1, GST-tagged, Active | +Inquiry |
JUN-2802R | Recombinant Rat JUN Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAH8-3122H | Recombinant Human DNAH8 protein, His-tagged | +Inquiry |
HDGFRP2-2820R | Recombinant Rat HDGFRP2 Protein | +Inquiry |
PRDM7-1938H | Recombinant Human PRDM7, His-tagged | +Inquiry |
◆ Native Proteins | ||
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
Ferritin-20M | Native Mouse Ferritin protein | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCAM1-858RCL | Recombinant Rat NCAM1 cell lysate | +Inquiry |
SNTB2-1657HCL | Recombinant Human SNTB2 cell lysate | +Inquiry |
STOM-1393HCL | Recombinant Human STOM 293 Cell Lysate | +Inquiry |
NR1D2-3721HCL | Recombinant Human NR1D2 293 Cell Lysate | +Inquiry |
ATP6V0B-149HCL | Recombinant Human ATP6V0B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ADGRL4 Products
Required fields are marked with *
My Review for All ADGRL4 Products
Required fields are marked with *
0
Inquiry Basket