Recombinant Human adenovirus F serotype 41 (HAdV-41) L3 protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | L3-7546H |
Product Overview : | Biotinylated Recombinant Human adenovirus F serotype 41 (HAdV-41) L3 protein(P11820)(609-925aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human adenovirus F serotype 41 (HAdV-41) |
Source : | E.coli |
Tag : | MBP&His&Avi |
ProteinLength : | 609-925a.a. |
Tag : | MBP&His&Avi |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 84.1 kDa |
AASequence : | NDTNDQSFNDYLCAANMLYPIPSNATSVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFTYSGSVPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLIQMLSHYNIGYQGFYVPESYKDRMYSFFRNFQPMSRQVVNTTTYKEYQNVTLPFQHNNSGFVGYMGPTMREGQAYPANYPYPLIGQTAVPSLTQKKFLCDRTMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRIHQPHRGVIEAVYLRTPFSAGNATT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
SERGEF-2530H | Recombinant Human SERGEF Protein, GST-tagged | +Inquiry |
CCR7-855H | Active Recombinant Human CCR7 Full Length Transmembrane protein, Flag-tagged(MNP) | +Inquiry |
SRSF8-4294R | Recombinant Rhesus Macaque SRSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP2B6-231H | Recombinant Human CYP2B6 | +Inquiry |
RFL493HF | Recombinant Full Length Human Olfactory Receptor 4C6(Or4C6) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TK10-030WCY | Human Kidney Renal Cell Adenocarcinoma TK10 Whole Cell Lysate | +Inquiry |
CDKN2AIP-7615HCL | Recombinant Human CDKN2AIP 293 Cell Lysate | +Inquiry |
VSTM2L-376HCL | Recombinant Human VSTM2L 293 Cell Lysate | +Inquiry |
CDO1-7608HCL | Recombinant Human CDO1 293 Cell Lysate | +Inquiry |
KIF3A-930HCL | Recombinant Human KIF3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All L3 Products
Required fields are marked with *
My Review for All L3 Products
Required fields are marked with *
0
Inquiry Basket