Recombinant Human ADCYAP1R1

• Cat.No.: ADCYAP1R1-28657TH
• Product Overview: Recombinant fragment corresponding to amino acids 21-120 of Human PACAP receptor with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
• Sequence Similarities: Belongs to the G-protein coupled receptor 2 family.

Gene Information

• Gene Name: ADCYAP1R1 adenylate cyclase activating polypeptide 1 (pituitary) receptor type I [ Homo sapiens ]
• Official Symbol: ADCYAP1R1
• Synonyms: ADCYAP1R1; adenylate cyclase activating polypeptide 1 (pituitary) receptor type I; pituitary adenylate cyclase-activating polypeptide type I receptor; PAC1; PAC1R; PACAP receptor 1; PACAPR
• Gene ID: 117
• mRNA Refseq: NM_001118
• Protein Refseq: NP_001109
• MIM: 102981
• Uniprot ID: P41586
• Chromosome Location: 7
• Pathway: Activation of TRKA receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
• Function: ADP-ribosylation factor binding; adenylate cyclase binding; neuropeptide binding; pituitary adenylate cyclase-activating polypeptide receptor activity; receptor activity