Recombinant Human ADCYAP1R1
Cat.No. : | ADCYAP1R1-28657TH |
Product Overview : | Recombinant fragment corresponding to amino acids 21-120 of Human PACAP receptor with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE |
Sequence Similarities : | Belongs to the G-protein coupled receptor 2 family. |
Gene Name | ADCYAP1R1 adenylate cyclase activating polypeptide 1 (pituitary) receptor type I [ Homo sapiens ] |
Official Symbol | ADCYAP1R1 |
Synonyms | ADCYAP1R1; adenylate cyclase activating polypeptide 1 (pituitary) receptor type I; pituitary adenylate cyclase-activating polypeptide type I receptor; PAC1; PAC1R; PACAP receptor 1; PACAPR; |
Gene ID | 117 |
mRNA Refseq | NM_001118 |
Protein Refseq | NP_001109 |
MIM | 102981 |
Uniprot ID | P41586 |
Chromosome Location | 7 |
Pathway | Activation of TRKA receptors, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function | ADP-ribosylation factor binding; adenylate cyclase binding; neuropeptide binding; pituitary adenylate cyclase-activating polypeptide receptor activity; receptor activity; |
◆ Cell & Tissue Lysates | ||
ADCYAP1R1-1642HCL | Recombinant Human ADCYAP1R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADCYAP1R1 Products
Required fields are marked with *
My Review for All ADCYAP1R1 Products
Required fields are marked with *
0
Inquiry Basket