Recombinant Human ADAT3 Protein, GST-tagged

• Cat.No.: ADAT3-318H
• Product Overview: Human ADAT3 full-length ORF ( NP_612431.1, 1 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a subunit of a tRNA-specific adenosine deaminase. This heterodimeric enzyme converts adenosine to inosine in the tRNA anticodon. A mutation in this gene causes a syndrome characterized by intellectual disability and strabismus. This gene shares its 5' exon with the overlapping gene, secretory carrier membrane protein 4 (Gene ID: 113178). [provided by RefSeq, Jul 2016]
• Molecular Mass: 64.5 kDa
• AA Sequence: MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAT3 adenosine deaminase, tRNA-specific 3 [ Homo sapiens ]
• Official Symbol: ADAT3
• Synonyms: ADAT3; adenosine deaminase, tRNA-specific 3; adenosine deaminase, tRNA specific 3, TAD3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase-like protein 3; TAD3; tRNA specific adenosine deaminase 3 homolog (S. cerevisiae); tRNA-specific adenosine deaminase 3 homolog; adenosine deaminase, tRNA-specific 3, TAD3 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT3; FWP005; MST121; S863-5; MSTP121
• Gene ID: 113179
• mRNA Refseq: NM_138422
• Protein Refseq: NP_612431
• UniProt ID: Q96EY9