Recombinant Human ADAT2 protein, GST-tagged

• Cat.No.: ADAT2-3737H
• Product Overview: Recombinant Human ADAT2 protein(33-193 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 33-193 aa
• AA Sequence: HMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ADAT2 adenosine deaminase, tRNA-specific 2 [ Homo sapiens ]
• Official Symbol: ADAT2
• Synonyms: ADAT2; adenosine deaminase, tRNA-specific 2; adenosine deaminase, tRNA specific 2, TAD2 homolog (S. cerevisiae) , DEADC1, deaminase domain containing 1; tRNA-specific adenosine deaminase 2; dJ20N2.1; TAD2; tRNA specific adenosine deaminase 2 homolog (S. cerevisiae); deaminase domain containing 1; deaminase domain-containing protein 1; tRNA-specific adenosine deaminase 2 homolog; adenosine deaminase, tRNA-specific 2, TAD2 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT2; DEADC1; dJ20N2
• Gene ID: 134637
• mRNA Refseq: NM_182503
• Protein Refseq: NP_872309
• UniProt ID: Q7Z6V5