Recombinant Human ADAMTS6 protein, His-tagged

• Cat.No.: ADAMTS6-2954H
• Product Overview: Recombinant Human ADAMTS6 protein(744-954 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 744-954 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: HIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEVGFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCPPEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVEKEPC

Gene Information

• Gene Name: ADAMTS6 ADAM metallopeptidase with thrombospondin type 1 motif, 6 [ Homo sapiens ]
• Official Symbol: ADAMTS6
• Synonyms: ADAMTS6; ADAM metallopeptidase with thrombospondin type 1 motif, 6; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; A disintegrin and metalloproteinase with thrombospondin motifs 6; a disintegrin and metalloproteinase with thrombospondin motifs 6; ADAM TS6; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; ADAM-TS6; ADAMTS-6; ADAM-TS 6
• Gene ID: 11174
• mRNA Refseq: NM_197941
• Protein Refseq: NP_922932
• MIM: 605008
• UniProt ID: Q9UKP5