Recombinant Human ADAMTS6 Protein, GST-tagged

• Cat.No.: ADAMTS6-308H
• Product Overview: Human ADAMTS6 partial ORF ( NP_922932.2, 725 a.a. - 824 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Expression of this gene may be regulated by the cytokine TNF-alpha. [provided by RefSeq, Mar 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: DSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTS6 ADAM metallopeptidase with thrombospondin type 1 motif, 6 [ Homo sapiens ]
• Official Symbol: ADAMTS6
• Synonyms: ADAMTS6; ADAM metallopeptidase with thrombospondin type 1 motif, 6; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; A disintegrin and metalloproteinase with thrombospondin motifs 6; a disintegrin and metalloproteinase with thrombospondin motifs 6; ADAM TS6; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 6; ADAM-TS6; ADAMTS-6; ADAM-TS 6
• Gene ID: 11174
• mRNA Refseq: NM_197941
• Protein Refseq: NP_922932
• MIM: 605008
• UniProt ID: Q9UKP5