Recombinant Human ADAMTS5 protein, GST-tagged

• Cat.No.: ADAMTS5-3632H
• Product Overview: Recombinant Human ADAMTS5 protein(417-558 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 417-558 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: GLSHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTK

Gene Information

• Gene Name: ADAMTS5 ADAM metallopeptidase with thrombospondin type 1 motif, 5 [ Homo sapiens ]
• Official Symbol: ADAMTS5
• Synonyms: ADAMTS5; ADAM metallopeptidase with thrombospondin type 1 motif, 5; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase 2); A disintegrin and metalloproteinase with thrombospondin motifs 5; ADAMTS11; ADMP 2; aggrecanase 2; aggrecanase-2; a disintegrin and metalloproteinase with thrombospondin motifs 11; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2); ADMP-2; ADAM-TS5; ADAMTS-5; ADAM-TS 5; ADAMTS-11; ADAM-TS 11
• Gene ID: 11096
• mRNA Refseq: NM_007038
• Protein Refseq: NP_008969
• MIM: 605007
• UniProt ID: Q9UNA0