Recombinant Human ADAM20 Protein, GST-tagged
Cat.No. : | ADAM20-281H |
Product Overview : | Human ADAM20 partial ORF ( NP_003805, 268 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The expression of this gene is testis-specific. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.75 kDa |
AA Sequence : | IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAM20 ADAM metallopeptidase domain 20 [ Homo sapiens ] |
Official Symbol | ADAM20 |
Synonyms | ADAM20; ADAM metallopeptidase domain 20; a disintegrin and metalloproteinase domain 20; disintegrin and metalloproteinase domain-containing protein 20; ADAM 20; |
Gene ID | 8748 |
mRNA Refseq | NM_003814 |
Protein Refseq | NP_003805 |
MIM | 603712 |
UniProt ID | O43506 |
◆ Recombinant Proteins | ||
ADAM20-9374H | Recombinant Human ADAM20, His-tagged | +Inquiry |
ADAM20-3001H | Recombinant Human ADAM20, His-tagged | +Inquiry |
ADAM20-7100C | Recombinant Chicken ADAM20 | +Inquiry |
ADAM20-0247H | Recombinant Human ADAM20 Protein (His367-Gly615), N-His-tagged | +Inquiry |
TCEAL6-4543H | Recombinant Human TCEAL6 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM20 Products
Required fields are marked with *
My Review for All ADAM20 Products
Required fields are marked with *
0
Inquiry Basket