Recombinant Human ADAM18 protein, GST-tagged
Cat.No. : | ADAM18-4622H |
Product Overview : | Recombinant Human ADAM18 protein(275-425 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 275-425 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LVYRKHPKYVGATFPGTVCNKSYDAGIAMYPDAIGLEGFSVIIAQLLGLNVGLTYDDITQCFCLRATCIMNHEAVSASGRKIFSNCSMHDYRYFVSKFETKCLQKLSNLQPLHQNQPVCGNGILESNEECDCGNKNECQFKKCCDYNTCKL |
Gene Name | ADAM18 ADAM metallopeptidase domain 18 [ Homo sapiens ] |
Official Symbol | ADAM18 |
Synonyms | ADAM18; ADAM metallopeptidase domain 18; a disintegrin and metalloproteinase domain 18; disintegrin and metalloproteinase domain-containing protein 18; putative ADAM18 gene product; ADAM27; tMDCIII; disintegrin and metalloproteinase domain-containing protein 18; ADAM 18; tMDC III; transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein III; MGC41836; MGC88272; |
Gene ID | 8749 |
mRNA Refseq | NM_001190956 |
Protein Refseq | NP_001177885 |
UniProt ID | Q9Y3Q7 |
◆ Recombinant Proteins | ||
ALOX5-638R | Recombinant Rat ALOX5 Protein | +Inquiry |
ALOX5-487H | Recombinant Human ALOX5 Protein, GST-tagged | +Inquiry |
ALOX5-723H | Recombinant Human Arachidonate 5-lipoxygenase 1 | +Inquiry |
ALOX5-0558H | Recombinant Human ALOX5 Protein (Mey1-IIe674), C-His-tagged | +Inquiry |
ALOX5-294R | Recombinant Rat ALOX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX5-8896HCL | Recombinant Human ALOX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALOX5 Products
Required fields are marked with *
My Review for All ALOX5 Products
Required fields are marked with *
0
Inquiry Basket