Recombinant Human ADAD1 protein, His-tagged

Cat.No. : ADAD1-9366H
Product Overview : Recombinant Human ADAD1 protein(1 - 260 aa), fused with His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length : 1 - 260 aa
AA Sequence : MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLSSISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYKTGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKISQIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name ADAD1 adenosine deaminase domain containing 1 (testis-specific) [ Homo sapiens ]
Official Symbol ADAD1
Synonyms ADAD1; adenosine deaminase domain containing 1 (testis-specific); adenosine deaminase domain-containing protein 1; Tenr; testis nuclear RNA-binding protein; FLJ32741;
Gene ID 132612
mRNA Refseq NM_001159285
Protein Refseq NP_001152757
MIM 614130
UniProt ID Q96M93

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADAD1 Products

Required fields are marked with *

My Review for All ADAD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon