Recombinant Human ADAD1 protein, His-tagged

• Cat.No.: ADAD1-9366H
• Product Overview: Recombinant Human ADAD1 protein(1 - 260 aa), fused with His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1 - 260 aa
• AA Sequence: MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLSSISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYKTGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKISQIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ADAD1 adenosine deaminase domain containing 1 (testis-specific) [ Homo sapiens ]
• Official Symbol: ADAD1
• Synonyms: ADAD1; adenosine deaminase domain containing 1 (testis-specific); adenosine deaminase domain-containing protein 1; Tenr; testis nuclear RNA-binding protein; FLJ32741
• Gene ID: 132612
• mRNA Refseq: NM_001159285
• Protein Refseq: NP_001152757
• MIM: 614130
• UniProt ID: Q96M93