Recombinant Human ACYP1 Protein, GST-tagged

• Cat.No.: ACYP1-264H
• Product Overview: Human ACYP1 full-length ORF ( AAH35568, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
• Molecular Mass: 36.63 kDa
• AA Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACYP1 acylphosphatase 1, erythrocyte (common) type [ Homo sapiens ]
• Official Symbol: ACYP1
• Synonyms: ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1; acylphosphate phosphohydrolase 1; acylphosphatase, erythrocyte isozyme; acylphosphatase, organ-common type isozyme; ACYPE
• Gene ID: 97
• mRNA Refseq: NM_001107
• Protein Refseq: NP_001098
• MIM: 600875
• UniProt ID: P07311