Recombinant Human ACVR2B Protein, Fc/His-tagged
Cat.No. : | ACVR2B-885H |
Product Overview : | Recombinant Human ACVR2B fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 19-134aa |
Description : | Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
Molecular Mass : | 41.3kD |
AA Sequence : | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | ACVR2B activin A receptor, type IIB [ Homo sapiens ] |
Official Symbol | ACVR2B |
Synonyms | ACVR2B; activin A receptor, type IIB; activin receptor type-2B; ActR IIB; HTX4; ACTRIIB; ActR-IIB; |
Gene ID | 93 |
mRNA Refseq | NM_001106 |
Protein Refseq | NP_001097 |
MIM | 602730 |
UniProt ID | Q13705 |
◆ Recombinant Proteins | ||
ACVR2B-6995H | Recombinant Human ACVR2B, GST-tagged | +Inquiry |
ACVR2B-1155H | Recombinant Human ACVR2B Protein, MYC/DDK-tagged | +Inquiry |
ACVR2B-2675H | Active Recombinant Human ACVR2B protein, hFc&His-tagged | +Inquiry |
ACVR2B-193C | Active Recombinant Cynomolgus ACVR2B | +Inquiry |
ACVR2B-011M | Active Recombinant Mouse ACVR2B Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR2B-2724HCL | Recombinant Human ACVR2B cell lysate | +Inquiry |
ACVR2B-2540MCL | Recombinant Mouse ACVR2B cell lysate | +Inquiry |
ACVR2B-734CCL | Recombinant Cynomolgus ACVR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR2B Products
Required fields are marked with *
My Review for All ACVR2B Products
Required fields are marked with *
0
Inquiry Basket