Recombinant Human ACVR2A Protein, Fc tagged

• Cat.No.: ACVR2A-14H
• Product Overview: Recombinant Human ACVR2A Protein with Fc-tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: Fc
• Protein Length: 21-134aa
• Description: This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.
• AA Sequence: ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: < 1.0 EU/μg of the protein as determined by the LAL method.
• Purity: > 90% as determined by SDS-PAGE
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions
• Storage: Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: PBS buffer

Gene Information

• Gene Name: ACVR2A activin A receptor, type IIA [ Homo sapiens (human) ]
• Official Symbol: ACVR2A
• Synonyms: ACVR2A; activin A receptor, type IIA; activin A receptor, type II, ACVR2; activin receptor type-2A; ACTRII; ACVR2
• Gene ID: 92
• mRNA Refseq: NM_001616
• Protein Refseq: NP_001607
• MIM: 102581
• UniProt ID: P27037