Recombinant Human ACTR8, His-tagged
Cat.No. : | ACTR8-19H |
Product Overview : | Recombinant Human Actin-Related Protein 8/ACTR8 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Trp329) of Human ACTR8 fused with a His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-329 a.a. |
Description : | Actin-Related Protein 8 (ACTR8) is a member of the Actin family. ACTR8 is the first example in actin family that was found to be associated with mitotic chromosomes. ACTR8 plays a vital role in the functional organization of mitotic chromosomes. This protein is a proposed core component of the chromatin remodeling INO80 complex that is involved in transcriptional regulation, DNA replication and probable DNA repair, and it is required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage. |
Form : | Supplied as a 0.2 μM filtered solution of PBS, 1mM DTT, pH 7.4 |
AA Sequence : | MNHKVHHHHHHMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTR IFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQG DPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGD GLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMF HKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQ RFGVRMLRERAAFVW |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
◆ Recombinant Proteins | ||
ACTR8-860HF | Recombinant Full Length Human ACTR8 Protein, GST-tagged | +Inquiry |
ACTR8-241H | Recombinant Human ACTR8 Protein, GST-tagged | +Inquiry |
ACTR8-205Z | Recombinant Zebrafish ACTR8 | +Inquiry |
ACTR8-1259M | Recombinant Mouse ACTR8 Protein | +Inquiry |
ACTR8-19H | Recombinant Human ACTR8, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTR8 Products
Required fields are marked with *
My Review for All ACTR8 Products
Required fields are marked with *
0
Inquiry Basket