Recombinant Human ACTR1A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ACTR1A-3248H
• Product Overview: ACTR1A MS Standard C13 and N15-labeled recombinant protein (NP_005727) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 42.6 kDa
• AA Sequence: MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ACTR1A actin related protein 1A [ Homo sapiens (human) ]
• Official Symbol: ACTR1A
• Synonyms: ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1; actin-RPV; centractin; centrosome-associated actin homolog; CTRN1; FLJ52695; FLJ52800; FLJ55002
• Gene ID: 10121
• mRNA Refseq: NM_005736
• Protein Refseq: NP_005727
• MIM: 605143
• UniProt ID: P61163