Recombinant Human ACTR1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ACTR1A-3248H |
Product Overview : | ACTR1A MS Standard C13 and N15-labeled recombinant protein (NP_005727) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ACTR1A actin related protein 1A [ Homo sapiens (human) ] |
Official Symbol | ACTR1A |
Synonyms | ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1; actin-RPV; centractin; centrosome-associated actin homolog; CTRN1; FLJ52695; FLJ52800; FLJ55002; |
Gene ID | 10121 |
mRNA Refseq | NM_005736 |
Protein Refseq | NP_005727 |
MIM | 605143 |
UniProt ID | P61163 |
◆ Recombinant Proteins | ||
ACTR1A-144R | Recombinant Rat ACTR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTR1A-54R | Recombinant Rhesus Macaque ACTR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTR1A-3248H | Recombinant Human ACTR1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACTR1A-226R | Recombinant Rhesus monkey ACTR1A Protein, His-tagged | +Inquiry |
ACTR1A-488R | Recombinant Rat ACTR1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR1A-9053HCL | Recombinant Human ACTR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTR1A Products
Required fields are marked with *
My Review for All ACTR1A Products
Required fields are marked with *
0
Inquiry Basket