Recombinant Human ACTR1A Protein, GST-tagged

• Cat.No.: ACTR1A-232H
• Product Overview: Human ACTR1A full-length ORF ( AAH00693, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. [provided by RefSeq, Jul 2008]
• Molecular Mass: 67.10 kDa
• AA Sequence: MESYDVSANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACTR1A ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) [ Homo sapiens ]
• Official Symbol: ACTR1A
• Synonyms: ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1; actin-RPV; centractin; centrosome-associated actin homolog; CTRN1; FLJ52695; FLJ52800; FLJ55002
• Gene ID: 10121
• mRNA Refseq: NM_005736
• Protein Refseq: NP_005727
• MIM: 605143
• UniProt ID: P61163