Recombinant Human ACTR1A, His-tagged

• Cat.No.: ACTR1A-26591TH
• Product Overview: Recombinant fragment, corresponding to amino acids 97-376 of Human ACTR1A with an N terminal His tag. Predicted MWt: 33 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 97-376 a.a.
• Description: This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 125 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPA LFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGF AMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFE IVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDL RRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKI RISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEED GARSIHRKTF

Gene Information

• Gene Name: ACTR1A ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) [ Homo sapiens ]
• Official Symbol: ACTR1A
• Synonyms: ACTR1A; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1 (actin related protein 1, yeast) homolog A (centractin alpha); alpha-centractin; ARP1
• Gene ID: 10121
• mRNA Refseq: NM_005736
• Protein Refseq: NP_005727
• MIM: 605143
• Uniprot ID: P61163
• Chromosome Location: 10q24
• Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem
• Function: ATP binding; nucleotide binding