Recombinant Human Active IL23A Protein, His-tagged

• Cat.No.: IL23A-02H
• Product Overview: Recombinant Human Active IL23A Protein with a His tag (N-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells.
• Form: Powder
• Bio-activity: Measured by its ability to induce IL-17 secretion in mouse splenocytes. The ED50 for this effect is < 0.5 ng/mL
• AA Sequence: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP with polyhistidine tag at the N-terminus.
• Endotoxin: < 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 95 % by SDS-PAGE
• Storage: Lyophilized protein should be stored at -20 centigrade. After reconstitution, aliquot and store at -20 or -80 centigrade for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ]
• Official Symbol: IL23A
• Synonyms: IL23A; interleukin 23 subunit alpha; P19; SGRF; IL-23; IL-23A; IL23P19; interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; IL-23p19; JKA3 induced upon T-cell activation; interleukin 23 p19 subunit; interleukin 23, alpha subunit p19; interleukin-23 subunit p19; interleukin-six, G-CSF related factor
• Gene ID: 51561
• mRNA Refseq: NM_016584
• Protein Refseq: NP_057668
• MIM: 605580
• UniProt ID: Q9NPF7

Q&As

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?

Please inquiry our product manager with specific product.