Recombinant Human ACTG1 protein(41-290 aa), C-His-tagged
Cat.No. : | ACTG1-2806H |
Product Overview : | Recombinant Human ACTG1 protein(P63261)(41-290 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 41-290 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIR |
Gene Name | ACTG1 actin, gamma 1 [ Homo sapiens ] |
Official Symbol | ACTG1 |
Synonyms | ACTG1; actin, gamma 1; ACTG, deafness, autosomal dominant 20; deafness, autosomal dominant 26 , DFNA20, DFNA26; actin, cytoplasmic 2; cytoskeletal gamma-actin; ACT; ACTG; DFNA20; DFNA26; |
Gene ID | 71 |
mRNA Refseq | NM_001199954 |
Protein Refseq | NP_001186883 |
MIM | 102560 |
UniProt ID | P63261 |
◆ Recombinant Proteins | ||
ACTG1-136R | Recombinant Rat ACTG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTG1-0366H | Recombinant Human ACTG1 Protein (Met1-Phe375), His-tagged | +Inquiry |
ACTG1-162H | Recombinant Human ACTG1 protein, T7-tagged | +Inquiry |
ACTG1-1242M | Recombinant Mouse ACTG1 Protein | +Inquiry |
ACTG1-269H | Recombinant Human ACTG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTG1-9064HCL | Recombinant Human ACTG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTG1 Products
Required fields are marked with *
My Review for All ACTG1 Products
Required fields are marked with *
0
Inquiry Basket