Recombinant Human ACSS3, His-tagged
Cat.No. : | ACSS3-18H |
Product Overview : | Recombinant Human Acyl-CoA Synthetase Short-Chain Family Member 3 Mitochondrial/ACSS3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala30-Ala686) of Human ACSS3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 30-686 a.a. |
Description : | Acyl-CoA Synthetase Short-Chain Family Member 3 Mitochondrial (ACSS3) is a member of the ATP-dependent AMP-binding enzyme family. ACSS3 localizes to the mitochondrion and catalyzes acetate and CoA into diphosphate and acetyl-CoA using the ATP. ACSS3 activates acetate for lipid synthesis use or for energy generation. Two isoforms of the human protein are produced by alternative splicing. |
AA Sequence : | AGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTL ENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGV LVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASF GIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVL SEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYG PLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFK TLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNV MILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYL YVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQ VLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHV EEMLKQAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | ACSS3 acyl-CoA synthetase short-chain family member 3 [ Homo sapiens ] |
Official Symbol | ACSS3 |
Synonyms | ACSS3; acyl-CoA synthetase short-chain family member 3; acyl-CoA synthetase short-chain family member 3, mitochondrial; FLJ21963; AMP-binding enzyme, 33217; |
Gene ID | 79611 |
mRNA Refseq | NM_024560 |
Protein Refseq | NP_078836 |
MIM | 614356 |
UniProt ID | Q9H6R3 |
Chromosome Location | 12q21.31 |
Pathway | Metabolic pathways, organism-specific biosystem; Propanoate metabolism, organism-specific biosystem; Propanoate metabolism, conserved biosystem; acetate conversion to acetyl-CoA, organism-specific biosystem; ethanol degradation II, organism-specific biosystem; ethanol degradation IV, organism-specific biosystem; oxidative ethanol degradation III, organism-specific biosystem; |
Function | ATP binding; acetate-CoA ligase activity; ligase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
ACSS3-4922H | Recombinant Human ACSS3 protein, His-tagged | +Inquiry |
ACSS3-18H | Recombinant Human ACSS3, His-tagged | +Inquiry |
ACSS3-265H | Recombinant Human ACSS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSS3-280M | Recombinant Mouse ACSS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Acss3-1514M | Recombinant Mouse Acss3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSS3-9067HCL | Recombinant Human ACSS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSS3 Products
Required fields are marked with *
My Review for All ACSS3 Products
Required fields are marked with *
0
Inquiry Basket